FJX1 anticorps

N° du produit ABIN634941

Cet anticorps anti-FJX1 est un anticorps Lapin Polyclonal détectant FJX1 dans WB. Adapté pour Humain, Rat et Souris.

Aperçu rapide pour FJX1 anticorps (ABIN634941)

Antigène: FJX1 (Four Jointed Box 1 (FJX1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FJX1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FJX1 anticorps

Purification: Affinity purified

Immunogène: FJX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVALERGGCGRSSNRLARFADGTRACVRYGINPEQIQGEALSYYLARLLG

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FJX1 Blocking Peptide, (ABIN5613592), is also available for use as a blocking control in assays to test for specificity of this FJX1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FJX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FJX1

Antigène: FJX1 (Four Jointed Box 1 (FJX1))

Autre désignation: FJX1

Sujet: FJX1 is the human ortholog of mouse and Drosophila four-jointed gene product. The Drosophila protein is important for growth and differentiation of legs and wings, and for proper development of the eyes. The exact function of FJX1 gene in humans is not known.

Poids moléculaire: 48 kDa (MW of target protein)